PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G01310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 388aa    MW: 42937.9 Da    PI: 6.6968
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G01310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.35.2e-52111381128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+v+yL +++++ k+++  +i+ev+iyk++PwdLp k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++ls
  OGLUM11G01310.1  11 LPPGFRFHPTDEELIVHYLMNQAASVKCPV-PIIAEVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSILS 103
                      79****************************.88***************8777899**************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++ ++g+kk Lvfykg+ pkg+ktdW+mheyrl
  OGLUM11G01310.1 104 TpTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRL 138
                      988899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-647169IPR003441NAC domain
PROSITE profilePS5100559.31511169IPR003441NAC domain
PfamPF023652.7E-2612138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MPSSGGAMPA LPPGFRFHPT DEELIVHYLM NQAASVKCPV PIIAEVNIYK CNPWDLPGKA  60
LFGENEWYFF SPRDRKYPNG ARPNRAAGSG YWKATGTDKS ILSTPTSDNI GVKKALVFYK  120
GKPPKGVKTD WIMHEYRLTG TSANSTKQRR ASSMTMRLDD WVLCRIHKKS NDFNSSDQHD  180
QEPEGSTVEQ LEDIHDNNSS EAPAPADMNN QQSDFQPMTA MMSMSKSCSL TDLLNTIDCA  240
ALSQFLLDGS SDAIAEPPAP PSPLIYTTPH PNYQTLNYNI NSNSSMPHAF ESRLDHHDGY  300
VNNYNVNGLR RKRMMACSAT SFDDGSSSND FVHAVVKKPQ LLPSDSRGSG FGGGYCNQQL  360
SETATGFQFQ NGNLLSHPFP LNNHLQMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-731117515174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235190.0AC123519.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0017B18, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615093.10.0PREDICTED: NAC transcription factor 29
SwissprotQ8H4S42e-84NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLA0A0E0BES40.0A0A0E0BES4_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g03300.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.17e-83NAC-like, activated by AP3/PI